Four exogastrula-inducing peptides, A, B, C, and D have been isolated from the homogenates of embryos of the sea urchin, Anthocidaris crassispina, with successive chromatographic fractionations. The complete amino acid sequences of the peptides A and D were determined by analysis of the peptides generated by their digestion with lysyl endopeptidase. They were composed of 52 and 53 amino acid residues, and their molecular weights were calculated to be 5754 and 5737, respectively. The sequences of peptides A and D were DSVYQCNRDTNSCDGFGKCEKSTFGRTTGQYICNCDDGYRNNAYGGCSPRTE, and DTVARCERDTKNCDGHGTCQLSTFGRRTGQYICFCDAGYRKPNSYGGCSPSSA, respectively. The biological significance of the exogastrula-inducing peptides was discussed.
| Predicate | Object |
|---|---|
| rdf:type | |
| rdfs:comment |
Four exogastrula-inducing peptides, A, B, C, and D have been isolated from the homogenates of embryos of the sea urchin, Anthocidaris crassispina, with successive chromatographic fractionations. The complete amino acid sequences of the peptides A and D were determined by analysis of the peptides generated by their digestion with lysyl endopeptidase. They were composed of 52 and 53 amino acid residues, and their molecular weights were calculated to be 5754 and 5737, respectively. The sequences of peptides A and D were DSVYQCNRDTNSCDGFGKCEKSTFGRTTGQYICNCDDGYRNNAYGGCSPRTE, and DTVARCERDTKNCDGHGTCQLSTFGRRTGQYICFCDAGYRKPNSYGGCSPSSA, respectively. The biological significance of the exogastrula-inducing peptides was discussed.
|
| skos:exactMatch | |
| uniprot:name |
Cell Differ. Dev.
|
| uniprot:author |
Asami-Yoshizumi T.,
Ishihara K.,
Noguchi S.,
Suyemitsu T.,
Tonegawa Y.
|
| uniprot:date |
1989
|
| uniprot:pages |
53-66
|
| uniprot:title |
The exogastrula-inducing peptides in embryos of the sea urchin, Anthocidaris crassispina -- isolation and determination of the primary structure.
|
| uniprot:volume |
26
|
| dc-term:identifier |
doi:10.1016/0922-3371(89)90783-1
|