| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
SEQUENCE 257 AA; 29071 MW; 9B9BC1A351CB1A3C CRC64;,
SUBUNIT: Binds tightly to multiple syntaxins. Preferentially binds to syntaxin 6. SUBCELLULAR LOCATION: Cytoplasm (By similarity). Membrane; Peripheral membrane protein (By similarity). Cell junction, synapse, synaptosome (By similarity). Note=Appears to be mostly membrane-bound, probably via interaction with syntaxins, but a significant portion is cytoplasmic (By similarity). TISSUE SPECIFICITY: Widely expressed. SIMILARITY: Belongs to the SNAP-25 family. SIMILARITY: Contains 1 t-SNARE coiled-coil homology domain. GENE SYNONYMS:Snap29. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.
|
| biopax3:xref | |
| biopax3:displayName |
SNP29_RAT
|
| biopax3:name |
Golgi SNARE of 32 kDa,
Gs32,
SNAP-29,
Snap29,
Soluble 29 kDa NSF attachment protein,
Vesicle-membrane fusion protein SNAP-29
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MSGYPKSYNPFDDDVEDEDTRPAPWKDARDLPDGPDPPIDRQQYLRQEVLRGPSATAASTSRSLFLMYESEKIGVASSEELVRQRGVLEHTEKMVDKMDQDLKMSQKHINSIKSVFGGFINYFKSKPVEPPPEQNGSIVPQPSSRLKEAINTSKDQESKYQASHPNLRRLHDAELDSVPASTVNTEVYPKNSSLRAYHQKIDSNLDELSVGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTEKKVRQL
|
| biopax3:standardName |
Synaptosomal-associated protein 29
|