Statements in which the resource exists as a subject.
PredicateObject
rdf:type
biopax3:comment
FUNCTION: Interacts with RB1 and EP300 and acts as a repressor of MYOD1 transactivation. Inhibits EP300 and CBP histone acetyltransferase activity. May be involved in coupling cell cycle exit to the transcriptional activation of genes required for cellular differentiation. May act as a candidate coinhibitory factor for NR0B2 that can be directly linked to transcription inhibitory mechanisms. SUBUNIT: Interacts via its LXCXE motif with the entire pocket region of RB1. Interacts with EP300, NR0B2 and TRIM27. SUBCELLULAR LOCATION: Nucleus. Cytoplasm. Note=May shuttle between nucleus and cytoplasm. ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9Y6B2-1; Sequence=Displayed; Name=2; IsoId=Q9Y6B2-2; Sequence=VSP_052454; Note=No experimental confirmation available; TISSUE SPECIFICITY: Widely expressed. Most abundantly expressed in heart, skeletal muscle, pancreas, brain and testis. Expressed at much lower levels in placenta and peripheral blood leukocyte. Barely detectable in lung. Also weakly expressed in lung carcinoma A-549 and various leukemia cell lines. DEVELOPMENTAL STAGE: Expression decreased with development in ventricular tissue while remaining highly expressed in adult atrial tissue. In primary cultures of human skeletal myocytes, expression decreased during myogenic differentiation (at protein level). INDUCTION: Down-regulated in differentiating U937 leukemia cells. PTM: Ubiquitinated in U-2OS osteosarcoma cells and is rapidly degraded by proteasome as cells exit the cell cycle exit. MISCELLANEOUS: Inhibition of MYOD1 may be partly due to the ability of EID1 to bind and inhibit EP300 histone acetyltransferase activity. SEQUENCE CAUTION: Sequence=AAK07524.1; Type=Erroneous initiation; GENE SYNONYMS:EID1 C15orf3 CRI1 RBP21. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License., SEQUENCE 187 AA; 20876 MW; A2815FA78ED0736D CRC64;
biopax3:xref
biopax3:displayName
EID1_HUMAN
biopax3:name
21 kDa pRb-associated protein, CREBBP/EP300 inhibitory protein 1, E1A-like inhibitor of differentiation 1, EID-1, EID1
biopax3:entityFeature
biopax3:organism
biopax3:sequence
MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRSGAQQLEEEGPMEEEEAQPMAAPEGKRSLANGPNAGEQPGQVAGADFESEDEGEEFDDWEDDYDYPEEEQLSGAGYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLAFIEELFSLMVVNRLTEELGCDEIIDRE
biopax3:standardName
EP300-interacting inhibitor of differentiation 1