| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
SEQUENCE 460 AA; 53637 MW; 6279465FEEB91F56 CRC64;,
SUBCELLULAR LOCATION: Secreted (By similarity). TISSUE SPECIFICITY: Expressed principally in liver. Weakly expressed in kidney. DISEASE: Defects in ANGPTL3 are the cause of familial hypobetalipoproteinemia type 2 (FHBL2) [MIM:605019]; also called combined hypobetalipoproteinemia familial. FHBL2 is a disorder of lipid metabolism characterized by less than 5th percentile age- and sex-specific levels of low density lipoproteins, and dietary fat malabsorption. Affected individuals present with combined hypolipidemia, consisting of extremely low plasma levels of LDL cholesterol, HDL cholesterol, and triglycerides. SIMILARITY: Contains 1 fibrinogen C-terminal domain. GENE SYNONYMS:ANGPTL3 ANGPT5. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.
|
| biopax3:xref | |
| biopax3:displayName |
ANGL3_HUMAN
|
| biopax3:name |
ANG-5,
ANGPTL3,
Angiopoietin-5,
Angiopoietin-like protein 3
|
| biopax3:organism | |
| biopax3:sequence |
MFTIKLLLFIVPLVISSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE
|
| biopax3:standardName |
Angiopoietin-related protein 3
|