| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. SUBUNIT: Component of the Mediator complex, which is composed of MED1, MED4, MED6, MED7, MED8, MED9, MED10, MED11, MED12, MED13, MED13L, MED14, MED15, MED16, MED17, MED18, MED19, MED20, MED21, MED22, MED23, MED24, MED25, MED26, MED27, MED29, MED30, MED31, CCNC, CDK8 and CDC2L6/CDK11. The MED12, MED13, CCNC and CDK8 subunits form a distinct module termed the CDK8 module. Mediator containing the CDK8 module is less active than Mediator lacking this module in supporting transcriptional activation. Individual preparations of the Mediator complex lacking one or more distinct subunits have been variously termed ARC, CRSP, DRIP, PC2, SMCC and TRAP. SUBCELLULAR LOCATION: Nucleus (Probable). SIMILARITY: Belongs to the Mediator complex subunit 31 family. GENE SYNONYMS:MED31 SOH1. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 131 AA; 15805 MW; 5DC672ADB994D015 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
MED31_HUMAN
|
| biopax3:name |
MED31,
Mediator complex subunit 31,
Mediator complex subunit SOH1,
hSOH1
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKDPEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNNTSGK
|
| biopax3:standardName |
Mediator of RNA polymerase II transcription subunit 31
|