Predicate | Object |
---|---|
rdf:type | |
biopax3:comment |
FUNCTION: Acts as a co-chaperone with an Hsp70 protein (By similarity). SUBCELLULAR LOCATION: Cytoplasm (By similarity). Nucleus (By similarity). Note=Stress induces its translocation to the nucleus (By similarity). SIMILARITY: Contains 1 J domain. GENE SYNONYMS:DNAJB9 MDG1. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 223 AA; 25518 MW; 59E3E57FF8B378BC CRC64;
|
biopax3:xref | |
biopax3:displayName |
DNJB9_HUMAN
|
biopax3:name |
DNAJB9,
Mdg-1,
Microvascular endothelial differentiation gene 1 protein
|
biopax3:organism | |
biopax3:sequence |
MATPQSIFIFAICILMITELILASKSYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREIAEAYETLSDANRRKEYDTLGHSAFTSGKGQRGSGSSFEQSFNFNFDDLFKDFGFFGQNQNTGSKKRFENHFQTRQDGGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFSGFDSTNQHTVQTENRFHGSSKHCRTVTQRRGNMVTTYTDCSGQ
|
biopax3:standardName |
DnaJ homolog subfamily B member 9
|