| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein- effector interaction. SUBUNIT: G proteins are composed of 3 units, alpha, beta and gamma. SUBCELLULAR LOCATION: Cell membrane; Lipid-anchor; Cytoplasmic side (Potential). SIMILARITY: Belongs to the G protein gamma family. GENE SYNONYMS:GNG12. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 72 AA; 8006 MW; A4C489A61697FAA9 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
GBG12_HUMAN
|
| biopax3:name |
GNG12
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MSSKTASTNNIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLIGIPTSENPFKDKKTCIIL
|
| biopax3:standardName |
Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12
|