Linked Life Data

Q9UBF6

Source:http://identifiers.org/uniprot/Q9UBF6

Statements in which the resource exists as a subject.
PredicateObject
rdf:type
biopax3:comment
FUNCTION: Probable component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription. Through the RING-type zinc finger, seems to recruit the E2 ubiquitination enzyme to the complex and brings it into close proximity to the substrate. Promotes the neddylation of CUL5 via its interaction with UBE2F. May play a role in protecting cells from apoptosis induced by redox agents. PATHWAY: Protein modification; protein ubiquitination. SUBUNIT: Probable part of SCF complexes, which consist of SKP1, CUL1, RNF7/RBX2 and a F-box protein. Interacts (preferentially) with CUL5. Also interacts (with lower preference) with CUL1, CUL2, CUL3, CUL4A and CUL4B. Interacts with UBE2F. Interacts with CSNK2B, the interaction is not affected by phosphorylation by CK2. SUBCELLULAR LOCATION: Cytoplasm. Nucleus. ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q9UBF6-1; Sequence=Displayed; Name=2; Synonyms=SAG-v; IsoId=Q9UBF6-2; Sequence=VSP_008449; Note=Inactive; Name=3; IsoId=Q9UBF6-3; Sequence=VSP_041444; TISSUE SPECIFICITY: Expressed in heart, liver, skeletal muscle and pancreas. At very low levels expressed in brain, placenta and lung. INDUCTION: By 1,10-phenanthroline. DOMAIN: The RING-type zinc finger domain is essential for ubiquitin ligase activity. It coordinates an additional third zinc ion. PTM: Phosphorylation by CK2 is required for efficient degradation of NFKBIA and CDKN1B. SIMILARITY: Belongs to the RING-box family. SIMILARITY: Contains 1 RING-type zinc finger. WEB RESOURCE: Name=Atlas of Genetics and Cytogenetics in Oncology and Haematology; URL="http://atlasgeneticsoncology.org/Genes/RNF7ID44108ch3q22.html"; GENE SYNONYMS:RNF7 RBX2 ROC2 SAG. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License., SEQUENCE 113 AA; 12683 MW; CE1E6CAC940C8257 CRC64;
biopax3:xref
biopax3:displayName
RBX2_HUMAN
biopax3:name
CKBBP1, CKII beta-binding protein 1, RING finger protein 7, RNF7, Rbx2, Regulator of cullins 2, Sensitive to apoptosis gene protein
biopax3:entityFeature
biopax3:organism
biopax3:sequence
MADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK
biopax3:standardName
RING-box protein 2