| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: May be involved in Ca(2+)-dependent exocytosis of secretory vesicles through Ca(2+) and phospholipid binding to the C2 domain or may serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis (By similarity). May mediate Ca(2+)-regulation of exocytosis in acrosomal reaction in sperm. COFACTOR: Binds 3 calcium ions per subunit. The ions are bound to the C2 domains (By similarity). SUBUNIT: Homodimer (isoform 1). Isoform 1 forms heterodimers with SytIII, SytV and SytX. Interacts with STX1A, STX1B and STX2; the interaction is Ca(2+)-dependent. Isoform 2 is not able to form homodimer and heterodimers. SUBCELLULAR LOCATION: Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Single-pass membrane protein. SUBCELLULAR LOCATION: Isoform 1: Membrane; Single-pass membrane protein. Note=Localized predominantly to endoplasmic reticulum (ER) and/or Golgi-like perinuclear compartment. SUBCELLULAR LOCATION: Isoform 2: Cytoplasm, cytosol. Cell membrane; Peripheral membrane protein. ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=2; Name=1; Synonyms=SytVI; IsoId=Q9R0N8-1; Sequence=Displayed; Name=2; Synonyms=SytVIdeltaTM1; IsoId=Q9R0N8-2; Sequence=VSP_041729; TISSUE SPECIFICITY: Isoform 1 is expressed in the olfactory bulb. Isoform 2 is expressed in the brain (at protein level). SIMILARITY: Belongs to the synaptotagmin family. SIMILARITY: Contains 2 C2 domains. GENE SYNONYMS:Syt6. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 511 AA; 57204 MW; C37C9305E3D05572 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
SYT6_MOUSE
|
| biopax3:name |
Synaptotagmin VI,
Syt6,
SytVI
|
| biopax3:organism | |
| biopax3:sequence |
MSGVWGAGGPRCQAALAVLASLCRARPPPLGLDVETCRSFELQSPEQSPSAADSGTSVSLLAVVVIVCGVALVAVFLFLFWKLCWMPWRKKEASSPSSANPASETLQSPSSRGNMADKLKDPSALGFLEAAVKISHTSPDIPAEVQMSVKEHIMRHTKLQRQTTEPASSTRHTSFKRHLPRQMHVSSVDYGNELPPAAAEQPTSIGRIKPELYKQKSVDGDDAKSEAAKSCGKINFSLRYDYESETLIVRILKAFDLPAKDFCGSSDPYVKIYLLPDRKCKLQTRVHRKTLNPTFDENFHFPVPYEELADRKLHLSVFDFDRFSRHDMIGEVILDNLFEASDLSRETSIWKDIQYATSESVDLGEIMFSLCYLPTAGRLTLTVIKCRNLKAMDITGYSDPYVKVSLLCDGRRLKKKKTTIKKNTLNPIYNEAIIFDIPPENMDQVSLLISVMDYDRVGHNEIIGVCRVGINAEGLGRDHWNEMLAYPRKPIAHWHSLVEVKKSFKEGTPRL
|
| biopax3:standardName |
Synaptotagmin-6
|