| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Probably modulates channels density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner. In vitro, modulates KCND1/Kv4.1 and KCND2/Kv4.2 currents. Seems to be involved in KCND2 trafficking to the cell surface. SUBUNIT: Component of heteromultimeric potassium channels. Interacts with KCND3 and the N-terminal domain of KCND2. Probably part of a complex consisting of KCNIP1, KCNIP2 isoform 3 and KCND2. Self-associates to form homodimers and homotetramers. Interacts with KCNIP2 isoform 3 in a calcium-dependent manner. Interacts with Naja atra venom CTX3. SUBCELLULAR LOCATION: Cell membrane; Peripheral membrane protein (By similarity). ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=4; Name=1; Synonyms=KCHIP1b; IsoId=Q9NZI2-1; Sequence=Displayed; Name=2; Synonyms=KCHIP1a; IsoId=Q9NZI2-2; Sequence=VSP_015044; Name=3; IsoId=Q9NZI2-3; Sequence=VSP_015043; Name=4; IsoId=Q9NZI2-4; Sequence=VSP_041511; TISSUE SPECIFICITY: Isoform 1 and isoform 2 are expressed in brain and kidney. Isoform 1 is also expressed in liver, pancreas, skeletal muscle, small intestine and testis. Isoform 2 is also expressed in lung, pancreas, leukocytes, prostate and thymus. SIMILARITY: Belongs to the recoverin family. SIMILARITY: Contains 4 EF-hand domains. GENE SYNONYMS:KCNIP1 KCHIP1 VABP. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 227 AA; 26817 MW; D39DD5F8EA13B0FD CRC64;
|
| biopax3:xref |
urn:biopax:RelationshipXref:HGNC_HGNC:15521,
urn:biopax:RelationshipXref:NCBI GENE_30820,
urn:biopax:RelationshipXref:REFSEQ_NP_001030009,
urn:biopax:RelationshipXref:REFSEQ_NP_055407,
urn:biopax:UnificationXref:UNIPROT_B7Z7B4,
urn:biopax:UnificationXref:UNIPROT_Q5U822,
urn:biopax:UnificationXref:UNIPROT_Q9NZI2
|
| biopax3:displayName |
KCIP1_HUMAN
|
| biopax3:name |
A-type potassium channel modulatory protein 1,
KCNIP1,
KChIP1,
Potassium channel-interacting protein 1,
Vesicle APC-binding protein
|
| biopax3:organism | |
| biopax3:sequence |
MGAVMGTFSSLQTKQRRPSKDIAWWYYQYQRDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLYRGFKNECPSGVVNEDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNVM
|
| biopax3:standardName |
Kv channel-interacting protein 1
|