Predicate | Object |
---|---|
rdf:type | |
biopax3:comment |
FUNCTION: Negative regulator of B-cell activation. Down-regulates cell proliferation (in vitro). Promotes RAC1-dependent membrane ruffle formation and reorganization of the actin cytoskeleton. Regulates cell spreading and cell polarization. Stimulates HDAC1 activity. Regulates LYN activity by modulating its tyrosine phosphorylation (By similarity). SUBUNIT: Interacts with FASLG. Interacts with phosphotyrosine containing proteins. Interacts (via SH3 domain) with CTTN. Interacts (phosphorylated at Ser-23) with YWHAB, YWHAE, YWHAG, YWHAH, YWHAZ and SFN. Interacts directly with SAP30 and HDAC1. Identified in a complex with SAP30 and HDAC1 (By similarity). SUBCELLULAR LOCATION: Nucleus. Cytoplasm (By similarity). Cell projection, ruffle (By similarity). Note=Shuttles between cytoplasm and nucleus. Colocalizes with the actin cytoskeleton and actin-rich membrane ruffles (By similarity). ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q9NSI8-1; Sequence=Displayed; Name=2; Synonyms=b; IsoId=Q9NSI8-2; Sequence=VSP_008119; Name=3; IsoId=Q9NSI8-3; Sequence=VSP_008120; TISSUE SPECIFICITY: Detected in peripheral blood B-cells (at protein level). Detected in spleen, liver and peripheral blood. INDUCTION: Up-regulated in peripheral blood B-cells by IL4, IL13 and by CD40 stimulation. SIMILARITY: Contains 1 SAM (sterile alpha motif) domain. SIMILARITY: Contains 1 SH3 domain. GENE SYNONYMS:SAMSN1 HACS1. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 373 AA; 41708 MW; 964B852ADBA2D777 CRC64;
|
biopax3:xref |
urn:biopax:RelationshipXref:HGNC_HGNC:10528,
urn:biopax:RelationshipXref:NCBI GENE_64092,
urn:biopax:RelationshipXref:REFSEQ_NP_001243299,
urn:biopax:RelationshipXref:REFSEQ_NP_071419,
urn:biopax:UnificationXref:UNIPROT_B3KWJ3,
urn:biopax:UnificationXref:UNIPROT_Q8NFF7,
urn:biopax:UnificationXref:UNIPROT_Q9C041,
urn:biopax:UnificationXref:UNIPROT_Q9NSI8
|
biopax3:displayName |
SAMN1_HUMAN
|
biopax3:name |
Hematopoietic adaptor containing SH3 and SAM domains 1,
Nash1,
SAM domain, SH3 domain and nuclear localization signals protein 1,
SAMSN1,
SH3-SAM adaptor protein
|
biopax3:entityFeature | |
biopax3:organism | |
biopax3:sequence |
MLKRKPSNVSEKEKHQKPKRSSSFGNFDRFRNNSLSKPDDSTEAHEGDPTNGSGEQSKTSNNGGGLGKKMRAISWTMKKKVGKKYIKALSEEKDEEDGENAHPYRNSDPVIGTHTEKVSLKASDSMDSLYSGQSSSSGITSCSDGTSNRDSFRLDDDGPYSGPFCGRARVHTDFTPSPYDTDSLKIKKGDIIDIICKTPMGMWTGMLNNKVGNFKFIYVDVISEEEAAPKKIKANRRSNSKKSKTLQEFLERIHLQEYTSTLLLNGYETLEDLKDIKESHLIELNIENPDDRRRLLSAAENFLEEEIIQEQENEPEPLSLSSDISLNKSQLDDCPRDSGCYISSGNSDNGKEDLESENLSDMVHKIIITEPSD
|
biopax3:standardName |
SAM domain-containing protein SAMSN-1
|