| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Prevents the interaction between CTNNB1 and TCF family members, and acts as negative regulator of the Wnt signaling pathway. SUBUNIT: Binds CTNNB1. SUBCELLULAR LOCATION: Cytoplasm (By similarity). Nucleus (By similarity). SIMILARITY: Belongs to the CTNNBIP1 family. GENE SYNONYMS:CTNNBIP1 ICAT. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 81 AA; 9170 MW; 3DA6CF90B50CE942 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
CNBP1_HUMAN
|
| biopax3:name |
CTNNBIP1,
Inhibitor of beta-catenin and Tcf-4
|
| biopax3:organism | |
| biopax3:sequence |
MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ
|
| biopax3:standardName |
Beta-catenin-interacting protein 1
|