| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Essential for cell viability. TAF9 and TAF9B are involved in transcriptional activation as well as repression of distinct but overlapping sets of genes. May have a role in gene regulation associated with apoptosis. TAFs are components of the transcription factor IID (TFIID) complex, the TBP-free TAFII complex (TFTC), the PCAF histone acetylase complex and the STAGA transcription coactivator-HAT complex. TFIID or TFTC are essential for the regulation of RNA polymerase II-mediated transcription. SUBUNIT: Binds TAF5 and TAF6. Component of TFIID and the TATA- binding protein-free TAF complex (TFTC). TFIID is composed of TATA binding protein (TBP) and a number of TBP-associated factors (TAFs). Binds N-terminal domain of p53/TP53 which is essential for transcription. SUBCELLULAR LOCATION: Nucleus (By similarity). SIMILARITY: Belongs to the TAF9 family. GENE SYNONYMS:TAF9B TAF9L. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 251 AA; 27622 MW; EB3A1116F7E8BCA0 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
TAF9B_HUMAN
|
| biopax3:name |
DN-7,
Neuronal cell death-related protein 7,
TAF9B,
Transcription initiation factor TFIID subunit 9-like,
Transcription-associated factor TAFII31L
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MESGKMAPPKNAPRDALVMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKPNVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQKNQTPLPLIKPYAGPRLPPDRYCLTAPNYRLKSLIKKGPNQGRLVPRLSVGAVSSKPTTPTIATPQTVSVPNKVATPMSVTSQRFTVQIPPSQSTPVKPVPATTAVQNVLINPSMIGPKNILITTNMVSSQNTANEANPLKRKHEDDDDNDIM
|
| biopax3:standardName |
Transcription initiation factor TFIID subunit 9B
|