| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Signaling adapter molecule involved in p75NTR/NGFR signaling. Plays a role in cell cycle progression and neuronal differentiation. Inhibits neuronal differentiation in response to nerve growth factor (NGF). May act as a link between the cell cycle and neurotrophic factor signaling, possibly by functioning as an upstream modulator of receptor signaling, coordinating biological responses to external signals with internal cellular states (By similarity). SUBUNIT: Interacts with neurotrophin receptor p75NTR/NGFR. Interacts with OMP (By similarity). SUBCELLULAR LOCATION: Nucleus. Cytoplasm. Note=Shuttles between the cytoplasm and the nucleus (By similarity). TISSUE SPECIFICITY: Expressed in central nervous system, with high level in pituitary, cerebellum and temporal lobe. Expressed in lung, skeletal muscle, peripheral blood leukocyte, stomach, lymph node, trachea and bone marrow. Highly expressed in acute myeloid leukemia. PTM: Phosphorylated. Phosphorylation of Ser-102 protects it from the proteasome (By similarity). PTM: Ubiquitinated. Degraded by the proteasome (By similarity). SIMILARITY: Belongs to the BEX family. CAUTION: Was named BEX2 by some authors. GENE SYNONYMS:BEX1. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 125 AA; 14860 MW; 2406DD71F7E663D2 CRC64;
|
| biopax3:xref |
urn:biopax:RelationshipXref:HGNC_HGNC:1036,
urn:biopax:RelationshipXref:NCBI GENE_55859,
urn:biopax:RelationshipXref:REFSEQ_NP_060946,
urn:biopax:UnificationXref:UNIPROT_A0AVN1,
urn:biopax:UnificationXref:UNIPROT_A8K4J3,
urn:biopax:UnificationXref:UNIPROT_Q9HBH7,
urn:biopax:UnificationXref:UNIPROT_Q9NZ33
|
| biopax3:displayName |
BEX1_HUMAN
|
| biopax3:name |
BEX1,
Brain-expressed X-linked protein 1
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MESKEKRAVNSLSMENANQENEEKEQVANKGEPLALPLDAGEYCVPRGNRRRFRVRQPILQYRWDMMHRLGEPQARMREENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHHDEFCLMP
|
| biopax3:standardName |
Protein BEX1
|