| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Modulates secretion by lacrimal acinar cells. SUBCELLULAR LOCATION: Secreted. TISSUE SPECIFICITY: Expressed in secretory granules of many acinar cells in lacrimal gland and in scattered acinar cells of salivary glands. GENE SYNONYMS:LACRT. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 138 AA; 14246 MW; 09910581E650F6FF CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
LACRT_HUMAN
|
| biopax3:name |
LACRT
|
| biopax3:organism | |
| biopax3:sequence |
MKFTTLLFLAAVAGALVYAEDASSDSTGADPAQEAGTSKPNEEISGPAEPASPPETTTTAQETSAAAVQGTAKVTSSRQELNPLKSIVEKSILLTEQALAKAGKGMHGGVPGGKQFIENGSEFAQKLLKKFSLLKPWA
|
| biopax3:standardName |
Extracellular glycoprotein lacritin
|