| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Probably involved in formation of autophagosomal vacuoles (autophagosomes). SUBUNIT: 3 different light chains, LC1, LC2 and LC3, can associate with MAP1A and MAP1B proteins (By similarity). Interacts at microtubules with CABP1 (via EF-hands 1 and 2) but not with calmodulin. Interacts with FYCO1 (via C-terminus). Interacts with TP53INP1 and TP53INP2. SUBCELLULAR LOCATION: Cytoplasm, cytoskeleton. Endomembrane system; Lipid-anchor. Cytoplasmic vesicle, autophagosome membrane; Lipid-anchor. Note=LC3-II binds to the autophagic membranes. TISSUE SPECIFICITY: Most abundant in heart, brain, skeletal muscle and testis. Little expression observed in liver. PTM: The precursor molecule is cleaved by APG4B/ATG4B to form LC3- I. This is activated by APG7L/ATG7, transferred to ATG3 and conjugated to phospholipid to form LC3-II. SIMILARITY: Belongs to the MAP1 LC3 family. CAUTION: PubMed:12740394 has shown that the protein is cleaved at Lys-122 but PubMed:15355958 has shown that the cleavage site is at Gly-120 as in other mammalian orthologs. GENE SYNONYMS:MAP1LC3B MAP1ALC3. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 125 AA; 14688 MW; BB141DEC7653E83F CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
MLP3B_HUMAN
|
| biopax3:name |
Autophagy-related protein LC3 B,
Autophagy-related ubiquitin-like modifier LC3 B,
MAP1 light chain 3-like protein 2,
MAP1A/MAP1B LC3 B,
MAP1A/MAP1B light chain 3 B,
MAP1LC3B,
Microtubule-associated protein 1 light chain 3 beta
|
| biopax3:organism | |
| biopax3:sequence |
MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV
|
| biopax3:standardName |
Microtubule-associated proteins 1A/1B light chain 3B
|