Statements in which the resource exists as a subject.
PredicateObject
rdf:type
biopax3:comment
FUNCTION: Component of the cleavage factor Im (CFIm) complex that plays a key role in pre-mRNA 3'-processing. Involved in association with CPSF6 or CPSF7 in pre-MRNA 3'-end poly(A) site cleavage and poly(A) addition. NUDT21/CPSF5 binds to cleavage and polyadenylation RNA substrates. The homodimer mediates simultaneous sequence-specific recognition of two 5'-UGUA-3' elements within the pre-mRNA. Binds to, but does not hydrolyze mono- and di-adenosine nucleotides. May have a role in mRNA export (By similarity). SUBUNIT: Homodimer. Component of the cleavage factor Im (CFIm) complex, composed of, at least, NUDT21/CPSF5 and CPSF6 or CPSF7. Within the cleavage factor Im complex, the NUDT21/CPSF5 homodimer is at the core of a heterotetramer, and is clasped by two additional subunits (CPSF6 or CPSF7). Interacts with CPSF6, CPSF7, PABPN1 and SNRNP70. Interacts with PAPOLA; the interaction is diminished by acetylation (By similarity). SUBCELLULAR LOCATION: Nucleus (By similarity). Note=In punctate subnuclear structures localized adjacent to nuclear speckles, called paraspeckles (By similarity). PTM: Acetylated mainly by p300/CBP, recruited to the complex by CPSF6. Acetylation decreases interaction with PAPAO. Deacetylated by the class I/II HDACs, HDAC1, HDAC3 and HDAC10, and by the class III HDACs, SIRT1 AND SIRT2 (By similarity). SIMILARITY: Belongs to the Nudix hydrolase family. CPSF5 subfamily. SIMILARITY: Contains 1 nudix hydrolase domain. CAUTION: Lacks the conserved metal-binding residues in the NUDIX motif and is not expected to have hydrolase activity. GENE SYNONYMS:Nudt21 Cpsf5. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License., SEQUENCE 227 AA; 26240 MW; 93AEF53557811DC5 CRC64;
biopax3:xref
biopax3:displayName
CPSF5_MOUSE
biopax3:name
Nucleoside diphosphate-linked moiety X motif 21, Nudix motif 21, Nudt21
biopax3:entityFeature
biopax3:organism
biopax3:sequence
MSVVPPNRSQTGWPRGVNQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN
biopax3:standardName
Cleavage and polyadenylation specificity factor subunit 5