| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Induces growth and cell cycle arrests at the G1 phase of the cell cycle. FUNCTION: Proposed core component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair. SUBUNIT: Component of the chromatin remodeling INO80 complex; specifically part of a complex module associated with the helicase ATP-binding and the helicase C-terminal domain of INO80. Interacts with RP9. SUBCELLULAR LOCATION: Nucleus. Nucleus, nucleolus. SIMILARITY: Contains 1 HIT-type zinc finger. SEQUENCE CAUTION: Sequence=BAB21111.1; Type=Erroneous initiation; Note=Translation N-terminally extended; GENE SYNONYMS:INO80B HMGA1L4 PAPA1 ZNHIT4. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 356 AA; 38637 MW; 235C836556B5F91F CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
IN80B_HUMAN
|
| biopax3:name |
High mobility group AT-hook 1-like 4,
IES2 homolog,
INO80B,
PAP-1-associated protein 1,
PAPA-1,
Zinc finger HIT domain-containing protein 4,
hIes2
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MSKLWRRGSTSGAMEAPEPGEALELSLAGAHGHGVHKKKHKKHKKKHKKKHHQEEDAGPTQPSPAKPQLKLKIKLGGQVLGTKSVPTFTVIPEGPRSPSPLMVVDNEEEPMEGVPLEQYRAWLDEDSNLSPSPLRDLSGGLGGQEEEEEQRWLDALEKGELDDNGDLKKEINERLLTARQRALLQKARSQPSPMLPLPVAEGCPPPALTEEMLLKREERARKRRLQAARRAEEHKNQTIERLTKTAATSGRGGRGGARGERRGGRAAAPAPMVRYCSGAQGSTLSFPPGVPAPTAVSQRPSPSGPPPRCSVPGCPHPRRYACSRTGQALCSLQCYRINLQMRLGGPEGPGSPLLAT
|
| biopax3:standardName |
INO80 complex subunit B
|