| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Component of the nuclear pore complex, a complex required for the trafficking across the nuclear membrane (By similarity). SUBUNIT: Component of the p62 complex, a complex at least composed of NUP62, NUP54, and NUPL1. Interacts with NUTF2. Interacts with SRP1-alpha and Importin p97 proteins when they are together, but not with SRP1-alpha protein alone (By similarity). SUBCELLULAR LOCATION: Nucleus, nuclear pore complex (By similarity). Nucleus membrane; Peripheral membrane protein; Cytoplasmic side (By similarity). Nucleus membrane; Peripheral membrane protein; Nucleoplasmic side (By similarity). Note=Biased towards cytoplasmic side. Central region of the nuclear pore complex, within the transporter (By similarity). ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=2; Name=1; Synonyms=p58; IsoId=Q9BVL2-1; Sequence=Displayed; Name=2; IsoId=Q9BVL2-2; Sequence=VSP_007946, VSP_007947; DOMAIN: Contains FG repeats. PTM: O-glycosylated (By similarity). MISCELLANEOUS: In rat, the p62 complex contains two different isoforms of NUPL1. Isoform p45 has however not been isolated in human so far. SIMILARITY: Belongs to the NUPL1 family. SEQUENCE CAUTION: Sequence=BAA23706.2; Type=Erroneous initiation; GENE SYNONYMS:NUPL1 KIAA0410. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 599 AA; 60897 MW; 2CC32E2A1B9E5132 CRC64;
|
| biopax3:xref |
urn:biopax:RelationshipXref:HGNC_HGNC:20261,
urn:biopax:RelationshipXref:NCBI GENE_9818,
urn:biopax:RelationshipXref:REFSEQ_NP_001008564,
urn:biopax:RelationshipXref:REFSEQ_NP_054808,
urn:biopax:UnificationXref:UNIPROT_O43160,
urn:biopax:UnificationXref:UNIPROT_Q5JRG2,
urn:biopax:UnificationXref:UNIPROT_Q5JRG5,
urn:biopax:UnificationXref:UNIPROT_Q9BVL2
|
| biopax3:displayName |
NUPL1_HUMAN
|
| biopax3:name |
NUPL1,
Nucleoporin-like protein 1
|
| biopax3:organism | |
| biopax3:sequence |
MSTGFSFGSGTLGSTTVAAGGTSTGGVFSFGTGASSNPSVGLNFGNLGSTSTPATTSAPSSGFGTGLFGSKPATGFTLGGTNTGIATTITTGLTLGTPATTSAATTGFSLGFNKPAASATPFALPITSTSASGLTLSSALTSTPAASTGFTLNNLGGTTATTTTASTGLSLGGALAGLGGSLFQSTNTGTSGLGQNALGLTLGTTAATSTAGNEGLGGIDFSSSSDKKSDKTGTRPEDSKALKDENLPPVICQDVENLQKFVKEQKQVQEEISRMSSKAMLKVQEDIKALKQLLSLAANGIQRNTLNIDKLKIETAQELKNAEIALRTQKTPPGLQHEYAAPADYFRILVQQFEVQLQQYRQQIEELENHLATQANNSHITPQDLSMAMQKIYQTFVALAAQLQSIHENVKVLKEQYLGYRKMFLGDAVDVFETRRAEAKKWQNTPRVTTGPTPFSTMPNAAAVAMAATLTQQQQPATGPQPSLGVSFGTPFGSGIGTGLQSSGLGSSNLGGFGTSSGFGCSTTGASTFGFGTTNKPSGSLSAGFGSSSTSGFNFSNPGITASAGLTFGVSNPASAGFGTGGQLLQLKKPPAGNKRGKR
|
| biopax3:standardName |
Nucleoporin p58/p45
|