| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Molecular scaffold protein for various multimeric protein complexes. Acts as a module in the assembly of a multicomponent scaffold for the ERK pathway, linking ERK responses to specific agonists. At low concentrations it enhances ERK activation, whereas high concentrations lead to the inhibition of ERK activation. Also involved in response to hypoxia by acting as a negative regulator of HIF1A/HIF-1-alpha via its interaction with EGLN3/PHD3. May promote degradation of HIF1A. May act by recruiting signaling complexes to a specific upstream activator (By similarity). May also be involved in pre-mRNA splicing. SUBUNIT: Interacts with EGLN3/PHD3. Interacts with ERK signaling proteins MAP2K1/MEK1, MAP2K2/MEK2, LAMTOR3, ARAF/Raf-1, MAPK1/ERK2 and MAPK3/ERK1 (By similarity). Identified in the spliceosome C complex. SUBCELLULAR LOCATION: Cytoplasm (By similarity). Nucleus (By similarity). Note=Predominantly cytoplasmic (By similarity). Partially nuclear (By similarity). SIMILARITY: Belongs to the WD repeat MORG1 family. SIMILARITY: Contains 7 WD repeats. GENE SYNONYMS:WDR83 MORG1. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 315 AA; 34343 MW; CF5F59C1FAA432FE CRC64;
|
| biopax3:xref |
urn:biopax:RelationshipXref:HGNC_HGNC:32672,
urn:biopax:RelationshipXref:NCBI GENE_84292,
urn:biopax:RelationshipXref:REFSEQ_NP_001093207,
urn:biopax:RelationshipXref:REFSEQ_NP_115708,
urn:biopax:UnificationXref:UNIPROT_B2RAF1,
urn:biopax:UnificationXref:UNIPROT_Q53FT6,
urn:biopax:UnificationXref:UNIPROT_Q9BRX9
|
| biopax3:displayName |
WDR83_HUMAN
|
| biopax3:name |
MAPK organizer 1,
Mitogen-activated protein kinase organizer 1,
WDR83
|
| biopax3:organism | |
| biopax3:sequence |
MAFPEPKPRPPELPQKRLKTLDCGQGAVRAVRFNVDGNYCLTCGSDKTLKLWNPLRGTLLRTYSGHGYEVLDAAGSFDNSSLCSGGGDKAVVLWDVASGQVVRKFRGHAGKVNTVQFNEEATVILSGSIDSSIRCWDCRSRRPEPVQTLDEARDGVSSVKVSDHEILAGSVDGRVRRYDLRMGQLFSDYVGSPITCTCFSRDGQCTLVSSLDSTLRLLDKDTGELLGEYKGHKNQEYKLDCCLSERDTHVVSCSEDGKVFFWDLVEGALALALPVGSGVVQSLAYHPTEPCLLTAMGGSVQCWREEAYEAEDGAG
|
| biopax3:standardName |
WD repeat domain-containing protein 83
|