| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus. SUBUNIT: Binds RIP11. Interacts with VTI1A (By similarity). SUBCELLULAR LOCATION: Membrane; Peripheral membrane protein (By similarity). SIMILARITY: Belongs to the SNAP family. GENE SYNONYMS:NAPG SNAPG. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 312 AA; 34746 MW; C37D73C1AEFD48C8 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
SNAG_HUMAN
|
| biopax3:name |
N-ethylmaleimide-sensitive factor attachment protein gamma,
NAPG,
SNAP-gamma
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAVQLYQQTANVFENEERLRQAVELLGKASRLLVRGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDYVAAERCVRESYSIPGFNGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVPGGGIKKKSPATPQAKPDGVTATAADEEEDEYSGGLC
|
| biopax3:standardName |
Gamma-soluble NSF attachment protein
|