Predicate | Object |
---|---|
rdf:type | |
biopax3:comment |
FUNCTION: B-cell receptor specific for TNFSF13B/TALL1/BAFF/BLyS. Promotes the survival of mature B-cells and the B-cell response. SUBCELLULAR LOCATION: Membrane; Single-pass type III membrane protein (Probable). ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q96RJ3-1; Sequence=Displayed; Name=2; IsoId=Q96RJ3-2; Sequence=VSP_006505; Note=No experimental confirmation available; TISSUE SPECIFICITY: Highly expressed in spleen and lymph node, and in resting B-cells. Detected at lower levels in activated B-cells, resting CD4+ T-cells, in thymus and peripheral blood leukocytes. DISEASE: Defects in TNFRSF13C are the cause of immunodeficiency common variable type 4 (CVID4) [MIM:613494]; also called antibody deficiency due to BAFFR defect. CVID4 is a primary immunodeficiency characterized by antibody deficiency, hypogammaglobulinemia, recurrent bacterial infections and an inability to mount an antibody response to antigen. The defect results from a failure of B-cell differentiation and impaired secretion of immunoglobulins; the numbers of circulating B-cells is usually in the normal range, but can be low. SIMILARITY: Contains 1 TNFR-Cys repeat. WEB RESOURCE: Name=GeneReviews; URL="http://www.ncbi.nlm.nih.gov/sites/GeneTests/lab/gene/TNFRSF13C"; GENE SYNONYMS:TNFRSF13C BAFFR BR3. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 184 AA; 18864 MW; F2BFB98099A27138 CRC64;
|
biopax3:xref | |
biopax3:displayName |
TR13C_HUMAN
|
biopax3:name |
B-cell-activating factor receptor,
BAFF receptor,
BAFF-R,
BLyS receptor 3,
CD268,
TNFRSF13C
|
biopax3:organism | |
biopax3:sequence |
MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ
|
biopax3:standardName |
Tumor necrosis factor receptor superfamily member 13C
|