| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Receptor for gonadotropin releasing hormone II (GnRH II). This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system (Potential). SUBCELLULAR LOCATION: Cell membrane; Multi-pass membrane protein. ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q96P88-1; Sequence=Displayed; Name=2; Synonyms=GnRH-RII-5TM; IsoId=Q96P88-2; Sequence=VSP_001915; Note=No experimental confirmation available; TISSUE SPECIFICITY: Expressed in many tissues. PTM: Phosphorylated on the C-terminal cytoplasmic tail (Probable). SIMILARITY: Belongs to the G-protein coupled receptor 1 family. CAUTION: Could be the product of a pseudogene. This protein seems to be substantially shorter than orthologous proteins in related organisms. SEQUENCE CAUTION: Sequence=AAL27000.1; Type=Erroneous termination; Positions=179; Note=Translated as stop; Sequence=AAL27000.1; Type=Frameshift; Positions=9; GENE SYNONYMS:GNRHR2. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 178 AA; 19031 MW; D2CBC7A7F3F48FBD CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
GNRR2_HUMAN
|
| biopax3:name |
GNRHR2,
GnRH II receptor,
GnRH-II-R,
Type II GnRH receptor
|
| biopax3:organism | |
| biopax3:sequence |
MSAGNGTPWGSAAGEEVWAGSGVEVEGSELPTFSAAAKVRVGVTIVLFVSSAGGNLAVLWSVTRREPSQLRPSPVRRLFIHLAAADLLVTFVVMPLDATWNITVQWLAVDIACRTLMFLKLMATYSAAFLPVVIGLDRQAAVLNPLGSRSGVRKLLGAAWGLSFLLAFPQLFLFHTVH
|
| biopax3:standardName |
Putative gonadotropin-releasing hormone II receptor
|