| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: May be involved as a regulatory molecule in GPR24/MCH-R1 signaling. SUBUNIT: Interacts with GPR24/MCH-R1. SUBCELLULAR LOCATION: Cytoplasm. Cell membrane; Peripheral membrane protein. TISSUE SPECIFICITY: Expressed in brain, testis, placenta, heart, liver, skeletal muscle, kidney and stomach. SIMILARITY: Contains 1 MYND-type zinc finger. GENE SYNONYMS:ZMYND19 MIZIP. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 227 AA; 26433 MW; 906F0B51B670063A CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
ZMY19_HUMAN
|
| biopax3:name |
MCH-R1-interacting zinc finger protein,
Melanin-concentrating hormone receptor 1-interacting zinc finger protein,
ZMYND19
|
| biopax3:organism | |
| biopax3:sequence |
MTDFKLGIVRLGRVAGKTKYTLIDEQDIPLVESYSFEARMEVDADGNGAKIFAYAFDKNRGRGSGRLLHELLWERHRGGVAPGFQVVHLNAVTVDNRLDNLQLVPWGWRPKAEETSSKQREQSLYWLAIQQLPTDPIEEQFPVLNVTRYYNANGDVVEEEENSCTYYECHYPPCTVIEKQLREFNICGRCQVARYCGSQCQQKDWPAHKKHCRERKRPFQHELEPER
|
| biopax3:standardName |
Zinc finger MYND domain-containing protein 19
|