| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Receptor for globular and full-length adiponectin (APM1), an essential hormone secreted by adipocytes that acts as an antidiabetic. Probably involved in metabolic pathways that regulate lipid metabolism such as fatty acid oxidation. Mediates increased AMPK, PPARA ligand activity, fatty acid oxidation and glucose uptake by adiponectin. Has some high-affinity receptor for globular adiponectin but low-affinity receptor for full-length adiponectin. SUBUNIT: May form homo and heteromultimers. SUBCELLULAR LOCATION: Membrane; Multi-pass membrane protein. Note=Localized to the cell membrane and intracellular organelles. TISSUE SPECIFICITY: Widely expressed. Highly expressed in skeletal muscle. Expressed at intermediate level in brain, heart, spleen, kidney, liver, placenta, lung and peripheral blood leukocytes. Weakly expressed in colon, thymus and small intestine. DOMAIN: The N-terminus is known to be cytoplasmic while the C- terminus is known to be extracellular. SIMILARITY: Belongs to the ADIPOR family. SEQUENCE CAUTION: Sequence=AAD34040.1; Type=Frameshift; Positions=369; GENE SYNONYMS:ADIPOR1 PAQR1 TESBP1A. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 375 AA; 42616 MW; 1CC0300A7D178EB0 CRC64;
|
| biopax3:xref |
urn:biopax:RelationshipXref:HGNC_HGNC:24040,
urn:biopax:RelationshipXref:NCBI GENE_51094,
urn:biopax:RelationshipXref:REFSEQ_NP_057083,
urn:biopax:UnificationXref:UNIPROT_B3KMB0,
urn:biopax:UnificationXref:UNIPROT_Q53HS7,
urn:biopax:UnificationXref:UNIPROT_Q53YY6,
urn:biopax:UnificationXref:UNIPROT_Q96A54,
urn:biopax:UnificationXref:UNIPROT_Q9Y360
|
| biopax3:displayName |
ADR1_HUMAN
|
| biopax3:name |
ADIPOR1,
Progestin and adipoQ receptor family member I
|
| biopax3:organism | |
| biopax3:sequence |
MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL
|
| biopax3:standardName |
Adiponectin receptor protein 1
|