Linked Life Data

Q92843

Source:http://identifiers.org/uniprot/Q92843

Statements in which the resource exists as a subject.
PredicateObject
rdf:type
biopax3:comment
FUNCTION: Promotes cell survival. Blocks dexamethasone-induced apoptosis. Mediates survival of postmitotic Sertoli cells by suppressing death-promoting activity of BAX. SUBCELLULAR LOCATION: Mitochondrion membrane; Peripheral membrane protein. Note=Loosely associated with the mitochondrial membrane in healthy cells. During apoptosis, tightly bound to the membrane. ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q92843-1; Sequence=Displayed; Name=3; Synonyms=BCL2L2-PABPN1; IsoId=Q92843-2; Sequence=VSP_042064; Note=Based on a readthrough transcript which may produce a BCL2L2-PABPN1 fusion protein. No experimental confirmation available; TISSUE SPECIFICITY: Expressed (at protein level) in a wide range of tissues with highest levels in brain, spinal cord, testis, pancreas, heart, spleen and mammary glands. Moderate levels found in thymus, ovary and small intestine. Not detected in salivary gland, muscle or liver. Also expressed in cell lines of myeloid, fibroblast and epithelial origin. Not detected in most lymphoid cell lines. DOMAIN: The BH4 motif seems to be involved in the anti-apoptotic function. DOMAIN: The BH1 and BH2 motifs form a hydrophobic groove which acts as a docking site for the BH3 domain of some pro-apoptotic proteins. The C-terminal residues of BCL2L2 fold into the BH3- binding cleft and modulate pro-survival activity by regulating ligand access. When BH3 domain-containing proteins bind, they displace the C-terminus, allowing its insertion into the membrane and neutralizing the pro-survival activity of BCL2L2. SIMILARITY: Belongs to the Bcl-2 family. SEQUENCE CAUTION: Sequence=BAA19666.2; Type=Erroneous initiation; Note=Translation N-terminally shortened; GENE SYNONYMS:BCL2L2 BCLW KIAA0271. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License., SEQUENCE 193 AA; 20746 MW; 3542243A532B1762 CRC64;
biopax3:xref
biopax3:displayName
B2CL2_HUMAN
biopax3:name
Apoptosis regulator Bcl-W, BCL2L2, Bcl2-L-2
biopax3:entityFeature
biopax3:organism
biopax3:sequence
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
biopax3:standardName
Bcl-2-like protein 2