| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Part of the complex catalyzing the transfer of N- acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis. CATALYTIC ACTIVITY: UDP-N-acetyl-D-glucosamine + 1-phosphatidyl- 1D-myo-inositol = UDP + 6-(N-acetyl-alpha-D-glucosaminyl)-1- phosphatidyl-1D-myo-inositol. PATHWAY: Glycolipid biosynthesis; glycosylphosphatidylinositol- anchor biosynthesis. SUBUNIT: Associates with PIGA, PIGH, PIGP, PIGQ and DPM2. The latter is not essential for activity. SUBCELLULAR LOCATION: Endoplasmic reticulum membrane; Multi-pass membrane protein (Potential). SIMILARITY: Belongs to the PIGC family. WEB RESOURCE: Name=Functional Glycomics Gateway - GTase; Note=Phosphatidylinositol N-acetylglucosaminyltransferase subunit C8; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_hum_556"; GENE SYNONYMS:PIGC GPI2. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 297 AA; 33583 MW; BD9584C5D5203A4B CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
PIGC_HUMAN
|
| biopax3:name |
2.4.1.198,
PIG-C,
PIGC,
Phosphatidylinositol-glycan biosynthesis class C protein
|
| biopax3:organism | |
| biopax3:sequence |
MYAQPVTNTKEVKWQKVLYERQPFPDNYVDRRFLEELRKNIHARKYQYWAVVFESSVVIQQLCSVCVFVVIWWYMDEGLLAPHWLLGTGLASSLIGYVLFDLIDGGEGRKKSGQTRWADLKSALVFITFTYGFSPVLKTLTESVSTDTIYAMSVFMLLGHLIFFDYGANAAIVSSTLSLNMAIFASVCLASRLPRSLHAFIMVTFAIQIFALWPMLQKKLKACTPRSYVGVTLLFAFSAVGGLLSISAVGAVLFALLLMSISCLCPFYLIRLQLFKENIHGPWDEAEIKEDLSRFLS
|
| biopax3:standardName |
Phosphatidylinositol N-acetylglucosaminyltransferase subunit C
|