| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Blue light-dependent regulator of the circadian feedback loop. Inhibits CLOCK|NPAS2-ARNTL E box-mediated transcription. Acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity. Has no photolyase activity. Capable of translocating circadian clock core proteins such as PER proteins to the nucleus. May inhibit CLOCK|NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL. COFACTOR: Binds 1 FAD per subunit (By similarity). COFACTOR: Binds 1 5,10-methenyltetrahydrofolate non-covalently per subunit (By similarity). SUBUNIT: Component of the circadian core oscillator, which includes the CRY proteins, CLOCK or NPAS2, ARNTL or ARNTL2, CSNK1D and/or CSNK1E, TIMELESS, and the PER proteins. Interacts directly with TIMELESS, PER1, PER2 and PER3. Interacts with NFIL3. Interacts with FBXL3. Interaction with PER2 inhibits its ubiquitination and vice versa (By similarity). SUBCELLULAR LOCATION: Cytoplasm (By similarity). Nucleus (By similarity). Note=Translocated to the nucleus through interaction with other Clock proteins such as PER2 or ARNTL (By similarity). TISSUE SPECIFICITY: Expressed in all tissues examined including heart, cerebellum, cerebral cortex, lung, liver, muscle, kidney and ovary. Highest levels in heart, liver and ovary. Highly expressed in the suprachiasmatic nucleus (SCN). PTM: Phosphorylation on Ser-265 by MAPK is important for the inhibition of CLOCK-ARNTL-mediated transcriptional activity. Phosphorylation by CSKNe requires interaction with PER1 or PER2 (By similarity). PTM: Ubiquitinated by the SCF(FBXL3) and SCF(FBXL21) complex, leading to its degradation (By similarity). SIMILARITY: Belongs to the DNA photolyase class-1 family. SIMILARITY: Contains 1 photolyase/cryptochrome alpha/beta domain. GENE SYNONYMS:Cry2. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 594 AA; 67223 MW; 9B99F650E3845E11 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
CRY2_RAT
|
| biopax3:name |
Cry2
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MAAAAVVAATVPVQSMGADGASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMELPKKPVGAVSSQHMENCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALVRLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYRKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAANCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLWASVPSCVEDLSHPVAEPGSSQAGSISNTGPRPLSSGPASPKRKLEAAEEPPGEELSKRARVTVTQMPAQEPPSKDS
|
| biopax3:standardName |
Cryptochrome-2
|