| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Receptor for metastin (kisspeptin-52 or kp-52), a C- terminally amidated peptide of KiSS1. KiSS1 is a metastasis suppressor protein. Activation of the receptor inhibits cell proliferation and cell migration, key characteristics of tumor metastasis. The receptor is essential for normal gonadotropin- released hormone physiology and for puberty. The hypothalamic KiSS1/KISS1R system is a pivotal factor in central regulation of the gonadotropic axis at puberty and in adulthood. Analysis of the transduction pathways activated by the receptor identifies coupling to phospholipase C and intracellular calcium release through pertussis toxin-insensitive G(q) proteins. SUBCELLULAR LOCATION: Cell membrane; Multi-pass membrane protein. TISSUE SPECIFICITY: Highest level in the heart and 15- and 17-day embryos. Low level in other tissues. Colocalized with gonadotropin-releasing hormone (GnRH) neurons in the hypothalamus. SIMILARITY: Belongs to the G-protein coupled receptor 1 family. GENE SYNONYMS:Kiss1r Gpr54. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 396 AA; 43061 MW; B5354E739A1F185B CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
KISSR_MOUSE
|
| biopax3:name |
G-protein coupled receptor 54,
G-protein coupled receptor OT7T175,
KiSS-1R,
Kiss1r,
Kisspeptins receptor,
Metastin receptor,
mOT7T175
|
| biopax3:organism | |
| biopax3:sequence |
MATEATLAPNVTWWAPSNASGCPGCGVNASDDPGSAPRPLDAWLVPLFFATLMLLGLVGNSLVIYVICRHKHMQTVTNFYIANLAATDVTFLLCCVPFTALLYPLPAWVLGDFMCKFVNYIQQVSVQATCATLTAMSVDRWYVTVFPLRALHRRTPRLALAVSLSIWVGSAAVSAPVLALHRLSPGPRTYCSEAFPSRALERAFALYNLLALYLLPLLATCACYGAMLRHLGRAAVRPAPTDGALQGQLLAQRAGAVRTKVSRLVAAVVLLFAACWGPIQLFLVLQALGPSGAWHPRSYAAYAVKIWAHCMSYSNSALNPLLYAFLGSHFRQAFCRVCPCCRQRQRRPHTSAHSDRAATHTVPHSRAAHPVRIRSPEPGNPVVRSPCAQSERTASL
|
| biopax3:standardName |
KiSS-1 receptor
|