| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Transcriptional repressor. SUBCELLULAR LOCATION: Nucleus. Note=Nuclear, in large foci. TISSUE SPECIFICITY: Highly expressed in testis. Detected at low levels in pancreas. Not detected in the other tissues tested. DOMAIN: The N-terminal half of the protein mediates transcription repression. MISCELLANEOUS: Does not bind methylated DNA. MISCELLANEOUS: The MBD3L proteins are encoded by strongly repeated regions of the 19p13 chromosome. The exact number of functional copies is unclear, and some of them may represent pseudogenes. SIMILARITY: Belongs to the MBD3L family. GENE SYNONYMS:MBD3L1 MBD3L. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 194 AA; 21616 MW; F9EC132573A45DC9 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
MB3L1_HUMAN
|
| biopax3:name |
MBD3-like protein 1,
MBD3L1
|
| biopax3:organism | |
| biopax3:sequence |
MAKSSQRKQRDCVNQCKSKPGLSTSIPLRMSSYTFKRPVTRITPHPGNEVRYHQWEESLEKPQQVCWQRRLQGLQAYSSAGELSSTLDLANTLQKLVPSYTGGSLLEDLASGLEHSCPMPHLACSSDAVEIIPAEGVGISQLLCKQFLVTEEDIRKQEGKVKTVRERLAIALIADGLANEAEKVRDQEGRPEKR
|
| biopax3:standardName |
Methyl-CpG-binding domain protein 3-like 1
|