Predicate | Object |
---|---|
rdf:type | |
biopax3:comment |
FUNCTION: May be involved in thymocyte signaling. SUBUNIT: Interacts with CD7. SUBCELLULAR LOCATION: Cell membrane; Single-pass type I membrane protein (Probable). Secreted. TISSUE SPECIFICITY: Detected at the highest levels in peripheral blood leukocytes and breast cancer cell lines. Found in leukocytes of the myeloid lineage, with the strongest expression observed in granulocytes and no detectable expression in lymphocytes. Expressed in thymic epithelial cells and fibroblasts. INDUCTION: By IFNG/IFN-gamma (at protein level). SIMILARITY: Belongs to the SECTM family. GENE SYNONYMS:SECTM1 K12. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 248 AA; 27039 MW; 21E3066B67920487 CRC64;
|
biopax3:xref | |
biopax3:displayName |
SCTM1_HUMAN
|
biopax3:name |
Protein K-12,
SECTM1
|
biopax3:organism | |
biopax3:sequence |
MQTCPLAFPGHVSQALGTLLFLAASLSAQNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWPVPAVVTAVFILLVALVMFAWYRCRCSQQRREKKFFLLEPQMKVAALRAGAQQGLSRASAELWTPDSEPTPRPLALVFKPSPLGALELLSPQPLFPYAADP
|
biopax3:standardName |
Secreted and transmembrane protein 1
|