| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: May modulate transcriptional activation by target nuclear receptors. Can act as transcriptional activator (in vitro) (By similarity). SUBUNIT: Interacts with RRARA, PPARD and PPARG. Interacts with THRB, RARA, RARG and RXRA in the presence of bound ligand (By similarity). SUBCELLULAR LOCATION: Nucleus. Cytoplasm (By similarity). GENE SYNONYMS:Nrbf2. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 287 AA; 32501 MW; 81B1C0A0CB575D2E CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
NRBF2_MOUSE
|
| biopax3:name |
NRBF-2,
Nrbf2
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHRKATTYLSEAMKLTESEQAHLSLELQRDSHMKQLLLIQERWKRAKREERLKAQQSTERDGAPHLQAPPRPSEDAEGQSPLLSQPYIPSTERRLPEVQGVFDRDPDTLLFLLQQKNEPSEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGTAEKELDVDADFVEKSELWGLPSHSESAAASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMND
|
| biopax3:standardName |
Nuclear receptor-binding factor 2
|