| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin- conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates E3 ubiquitin ligase activity either through direct binding to substrates or by functioning as the essential RING domain subunit of larger E3 complexes. Promotes monoubiquitination of SNCA (By similarity). Triggers the ubiquitin-mediated degradation of many substrates, including proteins involved in transcription regulation (POU2AF1, PML, NCOR1), a cell surface receptor (DCC), an antiapoptotic protein (BAG1), and a protein involved in synaptic vesicle function in neurons (SYP). It is thereby involved in apoptosis, tumor suppression, cell cycle, transcription and signaling processes. Has some overlapping function with SIAH1. Triggers the ubiquitin-mediated degradation of TRAF2, whereas SIAH1 can not. PATHWAY: Protein modification; protein ubiquitination. SUBUNIT: Homodimer. Interacts with VAV1, without mediating its ubiquitin-mediated degradation. Probable component of some large E3 complex possibly composed of UBE2D1, SIAH2, CACYBP/SIP, SKP1, APC and TBL1X. Interacts with UBE2I and UBE2E2. Interacts with PEG10, which may inhibit its activity. Interacts with PEG3 and EGLN2 (By similarity). Interacts with SNCAIP. SUBCELLULAR LOCATION: Cytoplasm. Nucleus (Probable). Note=Predominantly cytoplasmic (Probable). Partially nuclear (Probable). TISSUE SPECIFICITY: Detected in brain (at protein level). DOMAIN: The RING-type zinc finger domain is essential for ubiquitin ligase activity. DOMAIN: The SBD domain (substrate-binding domain) mediates the homodimerization and the interaction with substrate proteins. It is related to the TRAF family (By similarity). PTM: Phosphorylated at Thr-24 and Ser-29 by MAPK14, which mediates the degradation by the proteasome of PHD3 (By similarity). SIMILARITY: Belongs to the SINA (Seven in absentia) family. SIMILARITY: Contains 1 RING-type zinc finger. SIMILARITY: Contains 1 SIAH-type zinc finger. GENE SYNONYMS:Siah2. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 325 AA; 34700 MW; 0E273AD30959982E CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
SIAH2_RAT
|
| biopax3:name |
6.3.2.-,
Seven in absentia homolog 2,
Siah-2,
Siah2
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MSRPSSTGPSANKPCSKQPPPPQTPHAPSPAAPPAAATISAAGPGSSAVPAAAAVISGPGAGGGAGPVSPQHHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTISTCCQ
|
| biopax3:standardName |
E3 ubiquitin-protein ligase SIAH2
|