Statements in which the resource exists as a subject.
PredicateObject
rdf:type
biopax3:comment
FUNCTION: Rho GTPase-activating protein involved in cell polarity, cell morphology and cytoskeletal organization. Acts as a GTPase activator for the Rac-type GTPase by converting it to an inactive GDP-bound state. Controls actin remodeling by inactivating Rac downstream of Rho leading to suppress leading edge protrusion and promotes cell retraction to achieve cellular polarity. Able to suppress RAC1 and CDC42 activity in vitro. Overexpression induces cell rounding with partial or complete disruption of actin stress fibers and formation of membrane ruffles, lamellipodia, and filopodia. Isoform 2 is a vascular cell-specific GAP involved in modulation of angiogenesis. SUBUNIT: Interacts with FLNA. SUBCELLULAR LOCATION: Cytoplasm, cytoskeleton. Cell junction, adherens junction. Cell junction, focal adhesion. Cell projection. Note=Localizes to actin stress fibers. In migrating cells, localizes to membrane lamellae and protusions. ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=5; Name=1; IsoId=Q8N264-1; Sequence=Displayed; Name=2; IsoId=Q8N264-2; Sequence=VSP_023712, VSP_023715; Name=3; IsoId=Q8N264-3; Sequence=VSP_023711; Name=4; IsoId=Q8N264-4; Sequence=VSP_023717, VSP_023718; Note=No experimental confirmation available; Name=5; IsoId=Q8N264-5; Sequence=VSP_023713, VSP_023714, VSP_023716; Note=No experimental confirmation available; TISSUE SPECIFICITY: Isoform 1 is widely expressed with a higher level in kidney. Isoform 2 is mainly expressed in endothelial cells. INDUCTION: Isoform 2 is up-regulated during capillary tube formation in umbilical vein endothelial cells. DOMAIN: The coiled coil domain mediates the interaction with FLNA leading to its recruitment to lamellae. PTM: Phosphorylated by ROCK, leading to activate the RacGAP activity. SIMILARITY: Contains 1 PH domain. SIMILARITY: Contains 1 Rho-GAP domain. SEQUENCE CAUTION: Sequence=AAO65178.1; Type=Frameshift; Positions=Several; GENE SYNONYMS:ARHGAP24 FILGAP. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License., SEQUENCE 748 AA; 84258 MW; 87A8E6DCA6869229 CRC64;
biopax3:xref
biopax3:displayName
RHG24_HUMAN
biopax3:name
ARHGAP24, FilGAP, Filamin-A-associated RhoGAP, RAC1- and CDC42-specific GTPase-activating protein of 72 kDa, RC-GAP72, Rho-type GTPase-activating protein 24, RhoGAP of 73 kDa, Sarcoma antigen NY-SAR-88, p73RhoGAP
biopax3:entityFeature
biopax3:organism
biopax3:sequence
MEENNDSTENPQQGQGRQNAIKCGWLRKQGGFVKTWHTRWFVLKGDQLYYFKDEDETKPLGTIFLPGNKVSEHPCNEENPGKFLFEVVPGGDRDRMTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGGGIFGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDCGEKPSFDSNTDVHTVASLLKLYLRELPEPVIPYAKYEDFLSCAKLLSKEEEAGVKELAKQVKSLPVVNYNLLKYICRFLDEVQSYSGVNKMSVQNLATVFGPNILRPKVEDPLTIMEGTVVVQQLMSVMISKHDCLFPKDAELQSKPQDGVSNNNEIQKKATMGQLQNKENNNTKDSPSRQCSWDKSESPQRSSMNNGSPTALSGSKTNSPKNSVHKLDVSRSPPLMVKKNPAFNKGSGIVTNGSFSSSNAEGLEKTQTTPNGSLQARRSSSLKVSGTKMGTHSVQNGTVRMGILNSDTLGNPTNVRNMSWLPNGYVTLRDNKQKEQAGELGQHNRLSTYDNVHQQFSMMNLDDKQSIDSATWSTSSCEISLPENSNSCRSSTTTCPEQDFFGGNFEDPVLDGPPQDDLSHPRDYESKSDHRSVGGRSSRATSSSDNSETFVGNSSSNHSALHSLVSSLKQEMTKQKIEYESRIKSLEQRNLTLETEMMSLHDELDQERKKFTMIEIKMRNAERAKEDAEKRNDMLQKEMEQFFSTFGELTVEPRRTERGNTIWIQ
biopax3:standardName
Rho GTPase-activating protein 24