| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Binds to oleoyl-L-alpha-lysophosphatidic acid (LPA). Intracellular cAMP is involved in the receptor activation. Important for the maintenance of hair growth and texture (By similarity). SUBCELLULAR LOCATION: Cell membrane; Multi-pass membrane protein. TISSUE SPECIFICITY: Ubiquitously expressed. Detected in the hair follicles and skin (at protein level). SIMILARITY: Belongs to the G-protein coupled receptor 1 family. GENE SYNONYMS:Lpar6 P2ry5 P2y5. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 344 AA; 39439 MW; 50270D1D14AEDAB2 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
LPAR6_MOUSE
|
| biopax3:name |
LPA receptor 6,
LPA-6,
Lpar6,
Oleoyl-L-alpha-lysophosphatidic acid receptor,
P2Y purinoceptor 5,
P2Y5,
Purinergic receptor 5
|
| biopax3:organism | |
| biopax3:sequence |
MVSSNGSQCPYDDSFKYTLYGCMFSMVFVLGLISNCVAIYIFICALKVRNETTTYMINLAMSDLLFVFTLPFRIFYFATRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVYPFKSKTLRTKRNAKIVCIAVWFTVMGGSAPAVFFQSTHSQGNNTSEACFENFPAATWKTYLSRIVIFIEIVGFFIPLILNVTCSSMVLRTLNKPVTLSRSKMNKTKVLKMIFVHLVIFCFCFVPYNINLILYSLMRTQTFVNCSVVAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQNSIKMKNWSVRRSDSRFSEVQGTENFIQHNLQTLKNKIFDNESAI
|
| biopax3:standardName |
Lysophosphatidic acid receptor 6
|