| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Functions as part of the SSP (stage selector protein) complex, a complex that contributes to the preferential expression of the gamma-gene in fetal erythroid cells by facilitating the interaction of the gamma-globin genes with enhancer elements contained in the locus control region (LCR). The complex binds to the stage selector element (SSE) in the proximal gamma-globin promoter. In contrast, isoform 2 acts as a repressor of gamma- globin gene expression by preventing NFE2 and RNA polymerase II recruitment to the promoter. SUBUNIT: Component of the SSP (stage selector protein) complex, which appears to be a heteromer of TFCP2 and 2 copies of NFE4. Interacts with HDAC1 and PCAF. Isoform 2 interacts with TFCP2. SUBCELLULAR LOCATION: Nucleus (Probable). ALTERNATIVE PRODUCTS: Event=Alternative initiation; Named isoforms=2; Name=1; Synonyms=p22 NF-E4; IsoId=Q86UQ8-1; Sequence=Displayed; Name=2; Synonyms=p14 NF-E4; IsoId=Q86UQ8-2; Sequence=VSP_035468; TISSUE SPECIFICITY: Specifically expressed in fetal liver, cord blood and bone marrow. Also expressed in the K562 and HEL cell lines, which constitutively express the fetal globin genes. PTM: Acetylation at Lys-43 prolongs the protein half-life by preventing ubiquitin-mediated degradation and reduces the interaction between NF-E4 and HDAC1, potentially maximizing the activating ability of the factor at the gamma-promoter. PTM: Ubiquitinated; leading to its degradation by the proteasome. Acetylation at Lys-43 prevents ubiquitination. SEQUENCE CAUTION: Sequence=AAP13531.1; Type=Miscellaneous discrepancy; Note=Unusual initiator. The initiator methionine is coded by a non-canonical CTG leucine codon; GENE SYNONYMS:NFE4. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 179 AA; 19019 MW; 19925152D2ABBEB9 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
NFE4_HUMAN
|
| biopax3:name |
NFE4
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MPRVVCWHTLKSLNGYKNLSSGAETREGLRSSSPVDLPLRPRKQATAAGQRKLLSLQLLLCACTSVTDLTYWGPAGHGATAPHRSLLAIHLHLVPASSAAMKATGPHNAQTQVNPQGHAPSAEDPTGTWTVSGPCKDHPHPFLSQSNPPTRISSALPLKTDSALEQTPQQLPSLHLSQG
|
| biopax3:standardName |
Transcription factor NF-E4
|