Predicate | Object |
---|---|
rdf:type | |
biopax3:comment |
FUNCTION: Involved in the targeting and/or fusion of transport vesicles to their target membrane. SUBUNIT: Interacts with VAPA and VAPB (By similarity). SUBCELLULAR LOCATION: Isoform 1: Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Single-pass type IV membrane protein. Cell junction, synapse, synaptosome (By similarity). SUBCELLULAR LOCATION: Isoform 2: Cytoplasmic vesicle membrane; Single-pass type IV membrane protein. Note=Isoforms 2 and 3 are found in perinuclear as well as peripheral punctate structures in osteoblasts. SUBCELLULAR LOCATION: Isoform 3: Mitochondrion outer membrane; Single-pass type IV membrane protein. Note=Isoforms 2 and 3 are found in perinuclear as well as peripheral punctate structures in osteoblasts. ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=4; Name=1; Synonyms=Vamp1a; IsoId=Q63666-1; Sequence=Displayed; Name=2; Synonyms=Vamp1b; IsoId=Q63666-2; Sequence=VSP_029188; Name=3; Synonyms=Vamp1-ob; IsoId=Q63666-3; Sequence=VSP_029187; Name=4; IsoId=Q63666-4; Sequence=VSP_029189; TISSUE SPECIFICITY: Expressed in brain and spleen (at protein level). Isoform 1 expressed at very high level in brain. Even higher level found in spinal cord. Isoform 3 expressed in kidney, spleen and liver. Isoforms 2 and 3 expressed in osteoblasts of trabecular bone. Also expressed in heart. SIMILARITY: Belongs to the synaptobrevin family. SIMILARITY: Contains 1 v-SNARE coiled-coil homology domain. GENE SYNONYMS:Vamp1 Syb1. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 118 AA; 12797 MW; E34D4D735CFBF6A8 CRC64;
|
biopax3:xref |
urn:biopax:RelationshipXref:NCBI GENE_25624,
urn:biopax:RelationshipXref:RAT GENOME DATABASE_3948,
urn:biopax:RelationshipXref:REFSEQ_NP_037222,
urn:biopax:UnificationXref:UNIPROT_A6YSN3,
urn:biopax:UnificationXref:UNIPROT_O09025,
urn:biopax:UnificationXref:UNIPROT_Q56A22,
urn:biopax:UnificationXref:UNIPROT_Q63666,
urn:biopax:UnificationXref:UNIPROT_Q8CH14
|
biopax3:displayName |
VAMP1_RAT
|
biopax3:name |
Synaptobrevin-1,
VAMP-1,
Vamp1
|
biopax3:entityFeature | |
biopax3:organism | |
biopax3:sequence |
MSAPAQPPAEGTEGAAPGGGPPGPPPNTTSNRRLQQTQAQVEEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASVFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVIVIYIFT
|
biopax3:standardName |
Vesicle-associated membrane protein 1
|