| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Receptor for TNFSF6/FASLG. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death- inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. FAS- mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both (By similarity). SUBUNIT: Binds DAXX and RIPK1. Interacts with HIPK3. Part of a complex containing HIPK3 and FADD. Interacts with BRE and FEM1B (By similarity). Interacts with FADD (By similarity). SUBCELLULAR LOCATION: Membrane; Single-pass type I membrane protein. DOMAIN: Contains a death domain involved in the binding of FADD, and maybe to other cytosolic adapter proteins. SIMILARITY: Contains 1 death domain. SIMILARITY: Contains 3 TNFR-Cys repeats. GENE SYNONYMS:Fas Apt1 Tnfrsf6. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 324 AA; 36835 MW; D25D583C909D9D09 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
TNR6_RAT
|
| biopax3:name |
Apo-1 antigen,
Apoptosis-mediating surface antigen FAS,
CD95,
FASLG receptor,
Fas
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MLWIMAVLPLVLAGPELNVRMQGTDSIFEGLELKRSVRETDNNCSEGLYQVGPFCCQPCQPGERKVKDCTTSGGAPTCHPCTEGEEYTDRKHYSDKCRRCAFCDEGHGLEVETNCTRTQNTKCRCKENFYCNASLCDHCYHCTSCGLEDILEPCTRTSNTKCKKQSSNYKLLWLLILPGLAILFVFIYKRYRKRQPGDPESGIPSPESVPMNVSDVNLNKYIWRTAEKMKICDAKKFARQHKIPESKIDEIEHNSPQDAAEQKIQLLQCWYQSHGKTGACQALIQGLRKANRCDIAEEIQAMVWEDHENSISNSRNENEGQSLE
|
| biopax3:standardName |
Tumor necrosis factor receptor superfamily member 6
|