| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: This protein binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Represses transcription from promoters with ATF sites. It may repress transcription by stabilizing the binding of inhibitory cofactors at the promoter (By similarity). SUBUNIT: Binds DNA as a homodimer or a heterodimer. SUBCELLULAR LOCATION: Nucleus. SIMILARITY: Belongs to the bZIP family. ATF subfamily. SIMILARITY: Contains 1 bZIP domain. GENE SYNONYMS:Atf3. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 181 AA; 20722 MW; D641C8C6D14A457D CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
ATF3_MOUSE
|
| biopax3:name |
Activating transcription factor 3,
Atf3,
Transcription factor LRG-21,
cAMP-dependent transcription factor ATF-3
|
| biopax3:organism | |
| biopax3:sequence |
MMLQHPGQVSASEVSATAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVNNRPLEMSVTKSEAAPEEDERKRRRRERNKIAAAKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS
|
| biopax3:standardName |
Cyclic AMP-dependent transcription factor ATF-3
|