Statements in which the resource exists as a subject.
PredicateObject
rdf:type
biopax3:comment
FUNCTION: Involved in cell-matrix and cell-cell adhesion interactions that are required for normal development. May participate in the linkage between muscle fiber and basement membrane. May play a role in endochondral ossification of bone and branching morphogenesis of lung. Binds heparin. SUBUNIT: Homotrimer; disulfide-linked. Nucleation of the type XIII collagen triple helix is likely to occur at the N-terminal region with triple helix formation proceeding from the N- to the C- terminus. Interacts with FN1, perlecan/HSPG2 and NID2. SUBCELLULAR LOCATION: Cell membrane; Single-pass type II membrane protein. ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=10; Comment=Additional isoforms seem to exist; Name=1; IsoId=Q5TAT6-1; Sequence=Displayed; Name=2; IsoId=Q5TAT6-2; Sequence=VSP_052383; Note=Gene prediction based on EST data; Name=3; IsoId=Q5TAT6-3; Sequence=VSP_052383, VSP_052386; Note=Gene prediction based on EST data; Name=4; IsoId=Q5TAT6-4; Sequence=VSP_052383, VSP_052384, VSP_052386; Name=5; IsoId=Q5TAT6-5; Sequence=VSP_052384; Name=6; IsoId=Q5TAT6-6; Sequence=VSP_052385; Name=7; IsoId=Q5TAT6-7; Sequence=VSP_052385, VSP_052386; Name=8; IsoId=Q5TAT6-8; Sequence=VSP_052382, VSP_052386; Name=9; IsoId=Q5TAT6-9; Sequence=VSP_052383, VSP_052384, VSP_052386, VSP_052387; Name=10; IsoId=Q5TAT6-10; Sequence=VSP_043361, VSP_052382, VSP_052384; Note=No experimental confirmation available; TISSUE SPECIFICITY: Widely expressed in both fetal and adult ocular tissues (at protein level). In the eye, expression is accentuated in the ciliary muscle, optic nerve and the neural retina. In early placenta, localized to fibroblastoid stromal cells of the placental villi, to endothelial cells of developing capillaries and to cells of the cytotrophoblastic columns. Also detected in large decidual cells of the decidual membrane and to stromal cells of the gestational endometrium, but not in the epithelial cells in the endometrial glands. SEQUENCE CAUTION: Sequence=AAA51685.1; Type=Erroneous initiation; GENE SYNONYMS:COL13A1. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License., SEQUENCE 717 AA; 69950 MW; FD12CA80CC93540F CRC64;
biopax3:xref
urn:biopax:RelationshipXref:HGNC_HGNC:2190, urn:biopax:RelationshipXref:NCBI GENE_1305, urn:biopax:RelationshipXref:REFSEQ_NP_001123575, urn:biopax:RelationshipXref:REFSEQ_NP_542988, urn:biopax:RelationshipXref:REFSEQ_NP_542990, urn:biopax:RelationshipXref:REFSEQ_NP_542991, urn:biopax:RelationshipXref:REFSEQ_NP_542992, urn:biopax:UnificationXref:UNIPROT_A6NFR5, urn:biopax:UnificationXref:UNIPROT_B9EGD2, urn:biopax:UnificationXref:UNIPROT_Q13992, urn:biopax:UnificationXref:UNIPROT_Q13993, urn:biopax:UnificationXref:UNIPROT_Q13994, urn:biopax:UnificationXref:UNIPROT_Q13995, urn:biopax:UnificationXref:UNIPROT_Q13996, urn:biopax:UnificationXref:UNIPROT_Q5TAT4, urn:biopax:UnificationXref:UNIPROT_Q5TAT5, urn:biopax:UnificationXref:UNIPROT_Q5TAT6, urn:biopax:UnificationXref:UNIPROT_Q7KZ33, urn:biopax:UnificationXref:UNIPROT_Q7KZ49, urn:biopax:UnificationXref:UNIPROT_Q99228, urn:biopax:UnificationXref:UNIPROT_Q9NQ52
biopax3:displayName
CODA1_HUMAN
biopax3:name
COL13A1, COLXIIIA1
biopax3:organism
biopax3:sequence
MVAERTHKAAATGARGPGELGAPGTVALVAARAERGARLPSPGSCGLLTLALCSLALSLLAHFRTAELQARVLRLEAERGEQQMETAILGRVNQLLDEKWKLHSRRRREAPKTSPGCNCPPGPPGPTGRPGLPGDKGAIGMPGRVGSPGDAGLSIIGPRGPPGQPGTRGFPGFPGPIGLDGKPGHPGPKGDMGLTGPPGQPGPQGQKGEKGQCGEYPHRECLSSMPAALRSSQIIALKLLPLLNSVRLAPPPVIKRRTFQGEQSQASIQGPPGPPGPPGPSGPLGHPGLPGPMGPPGLPGPPGPKGDPGIQGYHGRKGERGMPGMPGKHGAKGAPGIAVAGMKGEPGIPGTKGEKGAEGSPGLPGLLGQKGEKGDAGNSIGGGRGEPGPPGLPGPPGPKGEAGVDGQVGPPGQPGDKGERGAAGEQGPDGPKGSKGEPGKGEMVDYNGNINEALQEIRTLALMGPPGLPGQIGPPGAPGIPGQKGEIGLPGPPGHDGEKGPRGKPGDMGPPGPQGPPGKDGPPGVKGENGHPGSPGEKGEKGETGQAGSPGEKGEAGEKGNPGAEVPGLPGPEGPPGPPGLQGVPGPKGEAGLDGAKGEKGFQGEKGDRGPLGLPGASGLDGRPGPPGTPGPIGVPGPAGPKGERGSKGDPGMTGPTGAAGLPGLHGPPGDKGNRGERGKKGSRGPKGDKGDQGAPGLDAPCPLGEDGLPVQGCWNK
biopax3:standardName
Collagen alpha-1(XIII) chain