| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Blue light-dependent regulator of the circadian feedback loop. Inhibits CLOCK|NPAS2-ARNTL E box-mediated transcription. Acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity. Has no photolyase activity. Capable of translocating circadian clock core proteins such as PER proteins to the nucleus. May inhibit CLOCK|NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL (By similarity). COFACTOR: Binds 1 FAD per subunit (By similarity). COFACTOR: Binds 1 5,10-methenyltetrahydrofolate non-covalently per subunit (By similarity). SUBUNIT: Component of the circadian core oscillator, which includes the CRY proteins, CLOCK or NPAS2, ARNTL or ARNTL2, CSNK1D and/or CSNK1E, TIMELESS, and the PER proteins. Interacts directly with TIMELESS and the PER proteins. Interacts directly with PER1 and PER2 C-terminal domains. Interaction with PER2 inhibits its ubiquitination and vice versa. Binds MAPK. Interacts with FBXL3 and FBXL21 (By similarity). SUBCELLULAR LOCATION: Cytoplasm (By similarity). Nucleus (By similarity). Note=Translocated to the nucleus through interaction with other Clock proteins such as PER2 or ARNTL (By similarity). INDUCTION: Expression is regulated by light and circadian rhythms. Peak expression in the suprachiasma nucleus (SCN) and eye at the day/night transition (CT12). PTM: Phosphorylation on Ser-247 by MAPK is important for the inhibition of CLOCK-ARNTL-mediated transcriptional activity. Phosphorylation by CSNK1E requires interaction with PER1 or PER2. Phosphorylation at Ser-71 and Ser-280 by AMPK destabilizes it (By similarity). PTM: Ubiquitinated by the SCF(FBXL3) and SCF(FBXL21) complex, leading to its degradation (By similarity). SIMILARITY: Belongs to the DNA photolyase class-1 family. SIMILARITY: Contains 1 photolyase/cryptochrome alpha/beta domain. GENE SYNONYMS:Cry1. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 588 AA; 66230 MW; 5D61B98485AFC77E CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
CRY1_RAT
|
| biopax3:name |
Cry1
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLVSKMEPLEMPADTITSDVIGKCTTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRGLGLLASVPSNPNGNGGLMGYAPGENVPSGGSGGGNCSQGSGILHYAHGDSQQTNPLKQGRSSMGTGLSSGKRPSQEEDAQSVGPKVQRQSSN
|
| biopax3:standardName |
Cryptochrome-1
|