Statements in which the resource exists as a subject.
PredicateObject
rdf:type
biopax3:comment
FUNCTION: Relays signals from the cell surface to the nucleus to weaken adherens junction and promote actin cytoskeleton reorganization and cell invasiveness. Involved in lysophosphatidic acid-induced cell adhesion and migration. Acts as a transcriptional coactivator for NF-kappa-B and JUN, and mediates the transrepression of these transcription factors induced by glucocorticoid receptor. SUBUNIT: Specifically interacts with the ligand binding domain of the thyroid receptor (TR) in the presence of thyroid hormone. Interacts with PTPN13. Interacts with SVIL isoform 2. Interacts with LPAR2 but not other LPA receptors. Interacts with PRKAA2. Interacts with MAGI1. Interacts with SCRIB (By similarity). Binds to S.typhimurium protein sseI. SUBCELLULAR LOCATION: Cytoplasm, cytoskeleton. Cell junction, focal adhesion. Nucleus. Cytoplasm. Note=Shuttles between nucleus and cytoplasm. TISSUE SPECIFICITY: Abundantly expressed in kidney, liver and lung. Lower levels in heart, placenta and pancreas. Expressed in colonic epithelial cells. Up-regulated in colonic tumors. DOMAIN: The LIM zinc-binding domains mediate interaction with LPAR2 and with S.typhimurium protein sseI. PTM: Phosphorylation at Tyr-55 by SRC is required for enhancement of lysophosphatidic acid-induced cell migration. Tyr-55 is dephosphorylated by PTPN13. SIMILARITY: Belongs to the zyxin/ajuba family. SIMILARITY: Contains 3 LIM zinc-binding domains. SEQUENCE CAUTION: Sequence=AAC41740.1; Type=Frameshift; Positions=461; GENE SYNONYMS:TRIP6 OIP1. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License., SEQUENCE 476 AA; 50288 MW; 2BA7C747DF30A8FD CRC64;
biopax3:xref
biopax3:displayName
TRIP6_HUMAN
biopax3:name
OIP-1, Opa-interacting protein 1, TR-interacting protein 6, TRIP-6, TRIP6, ZRP-1, Zyxin-related protein 1
biopax3:entityFeature
biopax3:organism
biopax3:sequence
MSGPTWLPPKQPEPARAPQGRAIPRGTPGPPPAHGAALQPHPRVNFCPLPSEQCYQAPGGPEDRGPAWVGSHGVLQHTQGLPADRGGLRPGSLDAEIDLLSSTLAELNGGRGHASRRPDRQAYEPPPPPAYRTGSLKPNPASPLPASPYGGPTPASYTTASTPAGPAFPVQVKVAQPVRGCGPPRRGASQASGPLPGPHFPLPGRGEVWGPGYRSQREPGPGAKEEAAGVSGPAGRGRGGEHGPQVPLSQPPEDELDRLTKKLVHDMNHPPSGEYFGQCGGCGEDVVGDGAGVVALDRVFHVGCFVCSTCRAQLRGQHFYAVERRAYCEGCYVATLEKCATCSQPILDRILRAMGKAYHPGCFTCVVCHRGLDGIPFTVDATSQIHCIEDFHRKFAPRCSVCGGAIMPEPGQEETVRIVALDRSFHIGCYKCEECGLLLSSEGECQGCYPLDGHILCKACSAWRIQELSATVTTDC
biopax3:standardName
Thyroid receptor-interacting protein 6