| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins. SUBUNIT: Component of the PA700 complex. SIMILARITY: Belongs to the proteasome subunit S10 family. SIMILARITY: Contains 1 PCI domain. GENE SYNONYMS:PSMD6 KIAA0107 PFAAP4. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 389 AA; 45531 MW; 8843E6684AE91ACD CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
PSMD6_HUMAN
|
| biopax3:name |
26S proteasome regulatory subunit RPN7,
26S proteasome regulatory subunit S10,
Breast cancer-associated protein SGA-113M,
PSMD6,
Phosphonoformate immuno-associated protein 4,
Proteasome regulatory particle subunit p44S10,
p42A
|
| biopax3:organism | |
| biopax3:sequence |
MPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMAPYYEALCKSLDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGALTAFRKTYDKTVALGHRLDIVFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRLKVYQGLYCVAIRDFKQAAELFLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKVIKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAVVEQEMKKDWLFAPHYRYYVREMRIHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPDSKNWQYQETIKKGDLLLNRVQKLSRVINM
|
| biopax3:standardName |
26S proteasome non-ATPase regulatory subunit 6
|