| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Nociceptin is the ligand of the opioid receptor-like receptor (OPRL1). It may act as a transmitter in the brain by modulating nociceptive and locomotor behavior. May be involved in neuronal differentiation and development (By similarity). SUBCELLULAR LOCATION: Secreted. TISSUE SPECIFICITY: Predominantly expressed in the brain and spinal cord. PTM: Specific enzymatic cleavages at paired basic residues probably yield other active peptides besides nociceptin. PTM: The N-terminal domain contains 6 conserved cysteines thought to be involved in disulfide bonding and/or processing. SIMILARITY: Belongs to the opioid neuropeptide precursor family. GENE SYNONYMS:PNOC OFQ. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 176 AA; 20295 MW; 8FC8DB4BB094CE6A CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
PNOC_HUMAN
|
| biopax3:name |
Neuropeptide 1,
Neuropeptide 2,
Nociceptin,
Orphanin FQ,
PNOC,
PPNOC
|
| biopax3:organism | |
| biopax3:sequence |
MKVLLCDLLLLSLFSSVFSSCQRDCLTCQEKLHPALDSFDLEVCILECEEKVFPSPLWTPCTKVMARSSWQLSPAAPEHVAAALYQPRASEMQHLRRMPRVRSLFQEQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQRRRTLHQNGNV
|
| biopax3:standardName |
Prepronociceptin
|