| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: May play a role in cell differentiation in the intestinal epithelium. SUBCELLULAR LOCATION: Membrane; Multi-pass membrane protein. ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q04941-1; Sequence=Displayed; Name=2; IsoId=Q04941-2; Sequence=VSP_041602; TISSUE SPECIFICITY: Enriched in colonic mucosa. The expression of A4 follows a gradient along the crypto-villus axis with the most abundant message occurring in the lower half of the crypt. SIMILARITY: Contains 1 MARVEL domain. GENE SYNONYMS:PLP2 A4. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 152 AA; 16691 MW; 689378A8C326206C CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
PLP2_HUMAN
|
| biopax3:name |
Differentiation-dependent protein A4,
Intestinal membrane A4 protein,
PLP2
|
| biopax3:organism | |
| biopax3:sequence |
MADSERLSAPGCWAACTNFSRTRKGILLFAEIILCLVILICFSASTPGYSSLSVIEMILAAIFFVVYMCDLHTKIPFINWPWSDFFRTLIAAILYLITSIVVLVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV
|
| biopax3:standardName |
Proteolipid protein 2
|