| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Transcriptional repressor of genes that require a bHLH protein for their transcription. May act as a negative regulator of myogenesis by inhibiting the functions of MYOD1 and ASH1. Binds DNA on N-box motifs: 5'-CACNAG-3' with high affinity and on E-box motifs: 5'-CANNTG-3' with low affinity. May play a role in a functional FA core complex response to DNA cross-link damage, being required for the stability and nuclear localization of FA core complex proteins, as well as for FANCD2 monoubiquitination in response to DNA damage (By similarity). SUBUNIT: Interacts with SIRT1. Interacts weakly with TLE2. Interacts with HES6 (By similarity). Transcription repression requires formation of a complex with a corepressor protein of the Groucho/TLE family. Interacts (via WPRW motif) with TLE1. Interacts with an FA complex, composed of FANCA, FANCF, FANCG and FANCL, but not of FANCC, nor FANCE (By similarity). SUBCELLULAR LOCATION: Nucleus. TISSUE SPECIFICITY: Present in all tissues examined but highest in epithelial cells and in mesoderm-derived tissues such as embryonal muscle cells. DOMAIN: Has a particular type of basic domain (presence of a helix-interrupting proline) that binds to the N-box (CACNAG), rather than the canonical E-box (CANNTG). DOMAIN: The C-terminal WRPW motif is a transcriptional repression domain necessary for the interaction with Groucho/TLE family members, transcriptional corepressors recruited to specific target DNA by Hairy-related proteins. DOMAIN: The bHLH, as well as cooperation between the central Orange domain and the C-terminal WRPW motif, is required for transcriptional repressor activity (By similarity). SIMILARITY: Contains 1 basic helix-loop-helix (bHLH) domain. SIMILARITY: Contains 1 Orange domain. GENE SYNONYMS:Hes1 Hes-1 Hl. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 281 AA; 29622 MW; 8A98C8964F075B0D CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
HES1_RAT
|
| biopax3:name |
Hairy and enhancer of split 1,
Hairy-like protein,
Hes1,
RHL
|
| biopax3:organism | |
| biopax3:sequence |
MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQAHPALQAPPPPPPSGPGGPQHAPFAPPPPLVPIPGGAAPPPGSAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGSSLTADSMWRPWRN
|
| biopax3:standardName |
Transcription factor HES-1
|