| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: May play an important role in B-cell differentiation as well as neural development and spermatogenesis. Involved in the regulation of the CD19 gene, a B-lymphoid-specific target gene. SUBUNIT: Interacts with DAXX (By similarity). Binds DNA as a monomer. Binds TLE4. SUBCELLULAR LOCATION: Nucleus. DEVELOPMENTAL STAGE: Expressed at early B-cell differentiation, in the developing CNS and in adult testis. PTM: O-glycosylated (Probable). DISEASE: Note=A chromosomal aberration involving PAX5 is a cause of acute lymphoblastic leukemia. Translocation t(9;18)(p13;q11.2) with ZNF521. Translocation t(9;3)(p13;p14.1) with FOXP1. Translocation t(9;12)(p13;p13) with ETV6. SIMILARITY: Contains 1 paired domain. WEB RESOURCE: Name=Atlas of Genetics and Cytogenetics in Oncology and Haematology; URL="http://atlasgeneticsoncology.org/Genes/PAX5ID62.html"; GENE SYNONYMS:PAX5. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 391 AA; 42149 MW; DB37E6EACD9F993A CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
PAX5_HUMAN
|
| biopax3:name |
B-cell-specific transcription factor,
BSAP,
PAX5
|
| biopax3:organism | |
| biopax3:sequence |
MDLEKNYPTPRTSRTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIRTKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQYSSYNDSWRFPNPGLLGSPYYYSAAARGAAPPAAATAYDRH
|
| biopax3:standardName |
Paired box protein Pax-5
|