| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: ID (inhibitor of DNA binding) HLH proteins lack a basic DNA-binding domain but are able to form heterodimers with other HLH proteins, thereby inhibiting DNA binding. ID-3 inhibits the binding of E2A-containing protein complexes to muscle creatine kinase E-box enhancer. May inhibit other transcription factors. SUBUNIT: Interacts with COPS5 and COPS7A (By similarity). Homodimer, and heterodimer with other HLH proteins. SUBCELLULAR LOCATION: Nucleus. TISSUE SPECIFICITY: Expressed abundantly in lung, kidney and adrenal gland, but not in adult brain. INDUCTION: By phorbol 12-myristate 13-acetate (PMA). SIMILARITY: Contains 1 basic helix-loop-helix (bHLH) domain. SEQUENCE CAUTION: Sequence=CAA47360.1; Type=Erroneous initiation; Note=Translation N-terminally shortened; GENE SYNONYMS:ID3 1R21 BHLHB25 HEIR1. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 119 AA; 12999 MW; 7FC38B56B4DCEFBC CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
ID3_HUMAN
|
| biopax3:name |
Class B basic helix-loop-helix protein 25,
Helix-loop-helix protein HEIR-1,
ID-like protein inhibitor HLH 1R21,
ID3,
Inhibitor of DNA binding 3,
bHLHb25
|
| biopax3:organism | |
| biopax3:sequence |
MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELTPELVISNDKRSFCH
|
| biopax3:standardName |
DNA-binding protein inhibitor ID-3
|