| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Involved in the activation cascade of caspases responsible for apoptosis execution. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Overexpression promotes programmed cell death (By similarity). CATALYTIC ACTIVITY: Strict requirement for an Asp residue at position P1 and has a preferred cleavage sequence of Asp-Glu-Val- Asp-|-. SUBUNIT: Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by a 20 kDa (p20) and a 11 kDa (p11) subunit. Interacts with BIRC6/bruce (By similarity). SUBCELLULAR LOCATION: Cytoplasm. TISSUE SPECIFICITY: Highly expressed in heart, lung, liver and kidney. Low levels in spleen, skeletal muscle and testis. No expression in the brain. PTM: Cleavages by granzyme B or caspase-10 generate the two active subunits. Propeptide domains can also be cleaved efficiently by caspase-3. Active heterodimers between the small subunit of caspase-7 and the large subunit of caspase-3, and vice versa, also occur (By similarity). SIMILARITY: Belongs to the peptidase C14A family. SEQUENCE CAUTION: Sequence=AAC53068.1; Type=Erroneous initiation; GENE SYNONYMS:Casp7 Lice2 Mch3. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 303 AA; 34061 MW; 747787B5BDE5F744 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
CASP7_MOUSE
|
| biopax3:name |
3.4.22.60,
Apoptotic protease Mch-3,
CASP-7,
Casp7,
Caspase-7 subunit p11,
Caspase-7 subunit p20,
Cysteine protease LICE2
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MTDDQDCAAELEKVDSSSEDGVDAKPDRSSIISSILLKKKRNASAGPVRTGRDRVPTYLYRMDFQKMGKCIIINNKNFDKATGMDVRNGTDKDAGALFKCFQNLGFEVTVHNDCSCAKMQDLLRKASEEDHSNSACFACVLLSHGEEDLIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDIDANPRNKIPVEADFLFAYSTVPGYYSWRNPGKGSWFVQALCSILNEHGKDLEIMQILTRVNDRVARHFESQSDDPRFNEKKQIPCMVSMLTKELYFSR
|
| biopax3:standardName |
Caspase-7
|