| Predicate | Object |
|---|---|
| rdf:type | |
| biopax3:comment |
FUNCTION: Required for the formation of membrane ruffles during macropinocytosis. Plays a role in cell migration and is required for the formation of cup-like structures during trans-endothelial migration of leukocytes. In case of Salmonella enterica infection, activated by SopB and ARHGEF26/SGEF, which induces cytoskeleton rearrangements and promotes bacterial entry. SUBUNIT: Interacts with ARHGEF26. Interacts with ARHGEF16. SUBCELLULAR LOCATION: Cell membrane; Lipid-anchor; Cytoplasmic side (Potential). SIMILARITY: Belongs to the small GTPase superfamily. Rho family. GENE SYNONYMS:RHOG ARHG. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License.,
SEQUENCE 191 AA; 21309 MW; 0C4FE9C54140F499 CRC64;
|
| biopax3:xref | |
| biopax3:displayName |
RHOG_HUMAN
|
| biopax3:name |
RHOG
|
| biopax3:entityFeature | |
| biopax3:organism | |
| biopax3:sequence |
MQSIKCVVVGDGAVGKTCLLICYTTNAFPKEYIPTVFDNYSAQSAVDGRTVNLNLWDTAGQEEYDRLRTLSYPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPTPIKRGRSCILL
|
| biopax3:standardName |
Rho-related GTP-binding protein RhoG
|